PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.21079s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 28612.2 Da    PI: 9.3974
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.21079s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.65.2e-312574150
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                          krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+
  Cagra.21079s0001.1.p 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 74
                          79***********************************************8 PP

2K-box114.31.2e-37961897100
                 K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                            s++ea+++++qqe++kL+++i+ +q+ +Rh++Ge+L+sL++keL++Le +Lek+++++RskKne+l+++ie++qk+e +lq++n++Lr
  Cagra.21079s0001.1.p  96 PSVTEANTQYYQQEASKLRRQIRDIQNLNRHIVGESLGSLNFKELKNLEGRLEKGISRVRSKKNEMLVAEIEYMQKREMDLQHDNMYLR 184
                           45899************************************************************************************ PP

                 K-box  96 kklee 100
                           +k++e
  Cagra.21079s0001.1.p 185 AKIAE 189
                           **986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.3051777IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-391776IPR002100Transcription factor, MADS-box
CDDcd002654.36E-441891No hitNo description
SuperFamilySSF554552.09E-321890IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-321939IPR002100Transcription factor, MADS-box
PfamPF003193.4E-262673IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-323954IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-325475IPR002100Transcription factor, MADS-box
PfamPF014869.4E-27101187IPR002487Transcription factor, K-box
PROSITE profilePS5129714.961103193IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEEGGSSHEA DSSKKIVGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA  60
LVIFSTRGRL YEYANNSVRG TIERYKKACS DAVNPPSVTE ANTQYYQQEA SKLRRQIRDI  120
QNLNRHIVGE SLGSLNFKEL KNLEGRLEKG ISRVRSKKNE MLVAEIEYMQ KREMDLQHDN  180
MYLRAKIAEG ARLNPSQQES SVIQGTTVYE SGVSTHHDQS HHYNRNYIPV NLLEPNQQFS  240
AQDQPPLQLV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A4e-201885168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-201885168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-201885168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D4e-201885168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P4e-201785169Myocyte-specific enhancer factor 2B
1tqe_Q4e-201785169Myocyte-specific enhancer factor 2B
1tqe_R4e-201785169Myocyte-specific enhancer factor 2B
1tqe_S4e-201785169Myocyte-specific enhancer factor 2B
3kov_A5e-201885168Myocyte-specific enhancer factor 2A
3kov_B5e-201885168Myocyte-specific enhancer factor 2A
3kov_I5e-201885168Myocyte-specific enhancer factor 2A
3kov_J5e-201885168Myocyte-specific enhancer factor 2A
3p57_A5e-201885168Myocyte-specific enhancer factor 2A
3p57_B5e-201885168Myocyte-specific enhancer factor 2A
3p57_C5e-201885168Myocyte-specific enhancer factor 2A
3p57_D5e-201885168Myocyte-specific enhancer factor 2A
3p57_I5e-201885168Myocyte-specific enhancer factor 2A
3p57_J5e-201885168Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00093SELEXTransfer from AT3G58780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5517700.0EU551770.1 Capsella bursa-pastoris SHATTERPROOF1a-like protein (SHP1a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293200.11e-178hypothetical protein CARUB_v10019520mg
SwissprotP293811e-175AGL1_ARATH; Agamous-like MADS-box protein AGL1
TrEMBLC1IDX20.0C1IDX2_CAPBU; SHATTERPROOF1a-like protein
STRINGfgenesh2_kg.5__2325__AT3G58780.11e-171(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33412350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.11e-176MIKC_MADS family protein